PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.A00142.1.p
Common NameLOC105977188, MIMGU_mgv1a005798mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family TALE
Protein Properties Length: 471aa    MW: 54299.6 Da    PI: 7.1959
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.A00142.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.3e-093924301854
                       HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       +F++  ++yp+ +e+  LA+k gLt +qV++WF N R +
  Migut.A00142.1.p 392 MFQNflHPYPKDAEKHLLAMKSGLTRSQVSNWFINARVR 430
                       5887779******************************88 PP

2BELL70.62.7e-23255323170
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiae 70 
                       er ++++k  +L+sll+ Vd++Y+q+ ++++tvis+F+av++l++ ++++++Al +iS  +++L+++i++
  Migut.A00142.1.p 255 ERDDVEAKMKHLISLLQLVDEQYNQCLDEIHTVISAFHAVTELDP-NLHARFALPTISLMYKNLRERISS 323
                       68899****************************************.**********************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.8E-23191323IPR006563POX domain
PfamPF075269.6E-25199322IPR006563POX domain
PROSITE profilePS5007111.143371434IPR001356Homeobox domain
SMARTSM003896.2E-6374438IPR001356Homeobox domain
CDDcd000866.21E-10374435No hitNo description
SuperFamilySSF466892.01E-15376442IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-26377439IPR009057Homeodomain-like
PfamPF059205.8E-15391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MQRNLVESHS FVTDRNSDPI DRQTRNHDPM SGFSLPLTLG ESHMTTFTNC NQIPTSIPLP  60
NSHELWLNTQ PQIPNIPFDN QDKLVPFQNN YPYESMNYAN YEGVPFDASI DRFTAPHQLG  120
NSVLNEWIPM DQRSLNPFSN ELSLSLEPSR TSPSIHDQCS SSLTSFSLQK RPSHHTSSST  180
NNNNNNLSLS CNSSSYKPGS KFFHAMQEIL AEIASYALES FDQMSFSKHC FRSTSHNGLD  240
NNNGGPVFRD KHSQERDDVE AKMKHLISLL QLVDEQYNQC LDEIHTVISA FHAVTELDPN  300
LHARFALPTI SLMYKNLRER ISSCIIEMGA RVNTTNNNNN NKGGGDESSS SFDMSYIQKQ  360
WDLQQLRKRD HQLWRPQRGL PERSVSVLRA WMFQNFLHPY PKDAEKHLLA MKSGLTRSQV  420
SNWFINARVR LWKPMIEEMC AEMNRRKNRR HDEEITDGAQ RNYMRFENRR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-14380438563Homeobox protein Meis2
3k2a_B1e-14380438563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012857929.10.0PREDICTED: homeobox protein ATH1
RefseqXP_012857930.10.0PREDICTED: homeobox protein ATH1
SwissprotP487314e-93ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A022Q1E40.0A0A022Q1E4_ERYGU; Uncharacterized protein
STRINGVIT_04s0008g00880.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.16e-91homeobox gene 1